Gastrin-Releasing Peptide,human
Cat.No:CLP1559 Solarbio
CAS:93755-85-2
Molecular Formula:C130H204N38O31S2
Molecular Weight:2859.38
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:93755-85-2
Molecular Formula:C130H204N38O31S2
Molecular Weight:2859.38
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
| Product Type | Peptides |
| CAS | 93755-85-2 |
| Sequence(1LC) | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
| Sequence(3LC) | Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 |
| Molecular Formula | C130H204N38O31S2 |
| Molecular Weight | 2859.38 |
| Purity | ≥95% |
| Appearance | Lyophilized powder |
| Solubility | H2O:100 mg/mL; *Ultrasonic solubilization; |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Hormone and Related Peptides |
| Background | Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release. |
| Reference | [1]. Dubovy SR, et al. Expression of hypothalamic neurohormones and their receptors in the human eye. Oncotarget. 2017 Jun 3. |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download