PACAP (1-27),human,ovine,rat
Cat.No:CLP1406 Solarbio
CAS:127317-03-7
Molecular Formula:C142H224N40O39S1
Molecular Weight:3147.66
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:127317-03-7
Molecular Formula:C142H224N40O39S1
Molecular Weight:3147.66
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
| Product Type | Peptides |
| CAS | 127317-03-7 |
| Sequence(1LC) | HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
| Sequence(3LC) | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
| Molecular Formula | C142H224N40O39S1 |
| Molecular Weight | 3147.66 |
| Purity | ≥95% |
| Appearance | Lyophilized powder |
| Solubility | DMSO:100 mg/mL; *Ultrasonic solubilization; |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Substrate and Enzyme Inhibitors |
| Background | PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively. |
| Reference | [1]. Gourlet P, et al. Fragments of pituitary adenylate cyclase activating polypeptide discriminate between type I and II recombinant receptors. Eur J Pharmacol. 1995 Dec 4;287(1):7-11. [2]. Sch?fer H, et al. Structural motifs of pituitary adenylate cyclase-activating polypeptide (PACAP) defining PAC1-receptor selectivity. Regul Pept. 1999 Feb 5;79(2-3):83-92. [3]. Lindén A, et al. Inhibition of bronchoconstriction by pituitary adenylate cyclase activating polypeptide (PACAP 1-27) in guinea-pigs in vivo. Br J Pharmacol. 1995 Jul;115(6):913-6. |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download