| Product Type |
Peptides |
|
|---|---|---|
![]() |
||
| Cat Number |
CLP0486 |
|
| Product Name |
Prolactin-Releasing Peptide (1-31), rat |
|
| CAS Number |
215510-06-8 |
|
| Sequence(1 LC) |
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
|
| Sequence(3 LC) |
Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
|
| Molecular Formula |
C156H242N54O43S1 |
|
| Molecular Weight |
3594.04 |
|
| Purity |
≥95% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
|
![]() |
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|