| Product Type |
Peptides |
|
|---|---|---|
![]() |
||
| Cat Number |
CLP1881 |
|
| Product Name |
Abaecin |
|
| CAS Number |
123997-18-2 |
|
| Sequence(1 LC) |
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
|
| Sequence(3 LC) |
Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
|
| Molecular Formula |
C187H270N48O43 |
|
| Molecular Weight |
3878.44 |
|
| Purity |
≥95.0% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
|
| Solubility |
Neuropeptide Y (3-36) (porcine) (0.24-24 nM; i.c.v.; single dose) induces feeding in the rat in a dose-dependent manner[1]. |
|
![]() |
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|