Product Specification
| Product Type |
Peptides |
|
|---|---|---|
 |
||
| Cat Number |
CLP1580 |
|
| Product Name |
Pancreastatin |
|
| CAS Number |
113817-19-9 |
|
| Sequence(1 LC) |
PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2 |
|
| Sequence(3 LC) |
Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2 |
|
| Molecular Formula |
C138H217N41O50S1 |
|
| Molecular Weight |
3282.51 |
|
| Purity |
≥95% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
|
|
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|